What is the size, MW and sequence of the TAP tag (yeast)?

Size of TAP tag (yeast): Adds 21kDa before TEV cleavage Adds 6kDa after TEV cleavage Molecular weight of the TAP tag: 19.5 kDalton Sequence (172 aa): SMEKRRWKKNFIAVSAANRFKKISSSGALDYDIPTTASENLYFQGELKTAALAQHDEAVDNFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPKVDNFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK

Share: